Describe and explain the concepsts visions and ethical behavior of 4 Essay

Describe and explain the concepsts visions and ethical behavior of 4 philosophers - Essay Example e no actions that have no specific causes, and so there are no actions emanating from will that are not caused by prior motives and circumstances, as well as human temperaments. He rejects that man enjoys liberty, therefore, and argues that man instead acts from necessity. As a skeptic, on the other hand, he argues that we must be modest when it comes to making judgments, because of the contradictions inherent in all reasoning of the mind, and when we do speculate on the nature of things, we must strive to stick to the facts and employ such activities on matters that require abstractions of the mind. He extends this skeptical stance to religion. As opposed to adhering to a religion of belief, moreover, he proposed a more natural religion. In matters of morality, moreover, he argues that it is the passions, instinct, and the psychological realities in man rather than rationality that govern the dynamics of human morality. The ultimate ground of his morality is not reason, but somethin g innate in us, a built in moral sense, and that moral sense must have come from God. It is this sense, in the gut or in the human sentiment, that is the true cause of moral virtues in man and not reason (Morris and Brown). In Kant we have the first synthesis of rationality and of empiricism as championed by Hume. In Kant the fulcrum of the moral philosophy is that man is capable of being autonomous. Human reason is the primary faculty that allows man to discern what is good from what is bad, from what is moral and not moral. He posits that the basis of all natural laws is the capacity of man for understanding, and from human rationality and human understanding flows human beliefs in the Divine, the eternity of souls, our notions of freedom, in other words the way we perceive and structure our experiences all spring from this ability of man to reason and to make sense of the world thus. This is the essence too of the autonomy of man, to be able to discern all this, and that because

Buyer behaviour- how buyer Behaviour Is Used In the Context of Essay

Buyer behaviour- how buyer Behaviour Is Used In the Context of Marketing - Essay Example Also gives the reader an insight about the influence of buyer behaviour on the development of Nestle MilkPak’s marketing mix within the packaged milk industry; it shows how the product, price, placement, and promotion of the product have been altered to best fit the consumers’ choice and also encourage positive buyer behaviour, which in turn induces consumer loyalty and attracts more consumers. In addition to this, the report also discusses the different marketing communication channels and how they are being used by the company to influence the consumer decision-making  process with regard to the consumer decision-making model, the technique that has been applied by the company and how it influences the purchase of their product.   Aims and Objectives: Following are the aims and objectives of the report: To understand the importance of buyer behaviour in the Packaged Milk Industry, specifically for Nestle MilkPak with regard to market segmentation, target market as well as product positioning. The influence of buyer behaviour on the development of Nestle MilkPak`s marketing mix within the packaged milk industry i.e. ... applied by the company and how it influences the purchase of their product.   Nestle The Company: In 1866, Henri Nestle founded the Nestle Company in Vevey, Switzerland and its headquarters are still based there to date. Its factories and operations are spread all over the world, with approximately 280,000 global employees. Its sales for 2010 were almost CHF 110 bn. Nestle is one of the top Nutrition, Health and Wellness companies in the world, pursuing the mission of "Good Food, Good Life". The company aims towards providing its consumers with tasty and nutritious food in a wide range of food and beverage categories. (Nestle.com 2011) Nestle MilkPak: MilkPak by Nestle is well known for its nutritious value and uncontaminated natural taste. It has added nutritious value of Iron, Vitamin C and Vitamin A, which is very beneficial for the health of the entire family. MilkPak is harmonized UHT milk that benefits from NESTLE’s expertise and is brimming with healthiness, wellness and nutrition. A single glass of MilkPak fulfils 20% Iron, 41% Calcium, 18% Vitamin A and 20% Vitamin C of an individuals’ daily requirement, as stated by Nutritional Reference Values, CODEX Alimentarius. (Nestle.pk 2007) Milk, as well as dairy products,  contain a vast quantity of nutrients and provide a shortcut of the supplying of these nutrients to the diet within moderately few calories. (The Dairy Council 2011) Milk is an important source of nutrition and its hygienic quality is important from public health point of view. (K. Muhammad, I. Altaf, A. Hanif, A. A. Anjum* and M. Y. Tipu 2009) Market Segmentation: Market segmentation can be divided into two broad categories, namely descriptive and behavioural. The descriptive market segmentation is done on the basis of descriptive

Green Fluorescent Protein (GFP) Mutants

Green Fluorescent Protein (GFP) Mutants GREEN FLUORESCENT PROTEIN (GFP) MUTANTS WITH ALTERED FLUORESCENCE INTENSITY AND EMMISSION SPECTRA Introduction: Now-a-days GFP is creating revolution in the field of science by its applications and properties.GFP is a stable protein extracted from the photo organs of the jellyfish Aequoria victoria by Shimomura et al in 1962. In 1992 the cloning of GFP has done. It is found in a variety of coelenterates (both hydrozoa and anthozoa) and it emits light by utilising energy from the Ca2+ activated photoprotein aequorin [1]. Energy transfer and the emission spectra of GFP can be affected by dimerization. Structure of GFP is cylindrical ÃŽ ²-can structure and has a chromophore located centrally. The chromophore is responsible for the fluorescence and the formation is independent of species but mainly depends on oxygen. GFP is a small protein and has been made up of 238 amino acids. Deletion of any seven amino acids either from C-terminus or N-terminus may result in the loss of fluorescence. Amino acid replacement is responsible for the change in colours of GFP. It has a molecular weight of 27 KDa an d has an absorption range at 488 nm and an emission range at 509 nm. It can accomplish high temperatures (65 ÌŠc) and basic PH range of 6-12 [2]. Increase in PH results in the decrease of fluorescence. Increase in the fluorescence and photo stability can be achieved by single point mutation at S65T. Fluorophore of the GFP is generated by using auto-catalytic process of continuous mechanisms. Visible excitation is one of the optical properties of GFP. Its derivatives are produced from the mutagenesis experiments like random and directed mutagenesis [3]. GFP is majorly used as a reporter in expressing genes. Protein and chromophore folding also constitutes as a major advantage of GFP. It can also be used in protein fusion by applying recombinant DNA technology. Aim of this research is to analyze properties of GFP by cloning, mutations, expression of proteins and purification. Objectives of this research are to sub-clone GFP into a vector and mutations are carried out by various mutagenesis experiments followed by expression of proteins and purification. Finally after purification properties are analyzed. Materials and methods: Initially DNA is isolated and GFPuv is sub-cloned into the pET28c vector from pET23 plasmid by speectrophotometric analysis. 5 µg of pET23GFPuv DNA is digested by using NdeI and HindIII restriction enzymes. And the digests are analysed by using Agarose gel electrophoresis. GFP fragment is extracted and purified using QIA quick gel extraction kit from QIAGEN and the recovered DNA is estimated. Recombinant protein is expressed in E.coli by ligation and transformation. To confirm the presence of GFP in the pET28c plasmid, colony PCR is used. Further mutagenesis experiments are carried out by designing oligonucleotide primers which will alter the spectral properties of the protein. Complementary primers containing same mutations are generated. Mutagenic primers are prepared with a melting temperature of ≠¥ 78 ºC, length between 25 and 45 bases and primers longer than 45 bases are generally used. Introduction and identification of mutations within GFPuv gene: Mutations are created in the GFPuv insert by site-directed mutagenesis Site-directed mutagenesis: 5 µl 10 x PCR buffer 5 µl 20 mM dNTP mixes 15 ng GFPuv-pET28c template DNA 125ng oligonucleotide primer F+ 125ng oligonucleotide primer R+ 2 µl 25mM MgSo4 32 µl sterile water 1 µl KOD hot start polymerase (1U/ µl) * All the above are added to 0.2ml PCR tubes and incubated in a PCR machine for 24 cycles: 94 ºC 30s 94 ºC 30s 55 ºC 1min 68 ºC 4min 20s 68 ºC 10 min * Reaction is then kept on ice for 2 min and 1 µl (1U) of Dpn1 is added and incubated for 60 min at 37 ºC Alignment of amino acid sequences is carried out using: http://www.ebi.ac.uk/Tools/clustalw2/index.html Product of site-directed mutagenesis (pET28c DNA) is transformed into XL-1 supercompetent cells. Transformed colonies are extracted using QIAprep Mini prep kit Qiagen [5]. Concentration and purity can be checked by using Agarose gel electrophoresis. For this 5 µl of plasmid preparation and 10U HindIII are digested at 37 ºC for 1h. Sequencing is then carried out by using 10 µl of DNA at a concentration of 50ng/ µl. E.coli BL21 (DE3) cells are prepared and are transformed into the pET28cGFPuv plasmid for expression Auto-induction method: Wild type protein (GFPuv) and the mutant protein are expressed in the expression vector [BL21 (DE3)] using auto-induction method. For this transformed colonies are inoculated into 3ml of LB-1D + antibiotic media and incubated at 37 ºC at 300 RPM for 6 hrs and O.D is taken. Inoculum is taken into the flask containing SB-5052 auto-induction medium along with antibiotic and incubated at 28 ºC at 300 RPM for 20 hrs. Cultures are then cooled for 1 hr. Total induced sample is prepared by taking 100 µl of cooling culture and 900 µl of SB-5052 media. Cells are then pelletized by centrifuging it with both total induced and non-induced samples and are resuspended in 100 µl of SDS-PAGE (sodium dodecyl sulphate (SDS) polyacrylamide gel electrophoresis(PAGE)) sample buffer. 12% of polyacrylamide gel is prepared and the Soluble and insoluble samples are prepared by cell fractionation using BUGBUSTER. For this 1 µl of DNAase1 is used along with reagents. Cell suspension is then centrifuged at 13000rpm for 20mins. Supernatant is then used as soluble sample and insoluble is prepared by resuspending the pellet in 2ml binding buffer. SDS-PAGE buffer and binding buffer are added to the soluble and insoluble fractions. At 95 ºC all samples are heated for 5 min. Gel is then loaded as: Molecular weight standard-5 µl Uninduced sample 5 µl Induced total sample 5 µl Soluble sample 5 µl Gel has to run for 1 hr. And is transfered to a box of Coomassie blue stain. Western blotting: GFP protein presence can be verified using western blotting technique. Protein samples are first seperated by SDS-PAGE and are transferred to the nitrocellulose membrane. GFP bound to nitrocellulose membrane is then visualised by incubating the blot with His-probe which is linked to a HRP (horse radish peroxidase) enzyme (HisprobeTM-HRP solution is diluted to 1:5000 (1 µl in 5ml) ). His-tag of GFP protein is bound to probe. Blots are kept in TBST and probes and thus probes are visualised by chemiluminescence and these are photographed by chemiluminescent reader. Ni-NTA chromatography: His tagged GFP can be purified by Ni-NTA (nickel nitrilo triacetic acid) chromatography method. In this, sample of soluble protein is loaded on column packed agarose resin and the non-specific protein binding is removed by washing resin with buffer and is eluted by high concentrated imidazole of elution buffer. After elution the purification of protein is done by SDS-PAGE and Coomassie staining. The concentration of the protein is measured by Bradford assay. Fluorimetry and mass spectrometry: Properties of GFPuv protein are analysed by Fluorimetry and mass spectroscopy. Fluorimetry: In this wavelength and intensity of a molecule at specific wavelength are measured using fluorimeters. Perkin Elmer LS50B is the fluorimeter used to measure GFP. Quartz cuvettes are placed in a chamber to measure the concentration and intensity. The parameters set to measure GFP are: Excitation 440nm Emission 460-550nm Slit widths 4 and 4 Accumulation 5 20 µg/ml of protein concentration is used. The emission and excitor wavelengths are set at 509nm and 395nm. Mass spectrometry: GFPuv properties and molecular mass can be analysed by mass spectroscopy. The type of mass spectroscopy used here is electron spray ionization (ESI). ESI is a type of atmospheric pressure ionisation technique (API) which is used for biochemical analysis. JEOL HX110/HX110A equipped with electron ion source tandem mass spectrometers are used to analyse structural properties [7]. 1-10 pmol/ µl of protein concentration is used. Solvents used are: MeOH MeCN TFA During ionisation sample is dissolved in a solvent and is pumped through a steel capillary at a rate of 1 µl/min and voltage of 3 or 4KV is applied [8]. Ion current is amplified by the detector and the data system will record signals in the form of mass spectrum. RESULTS: Site-directed mutagenesis: Primers used for site directed mutagenesis (Mutant) Forward primer: 5-CACTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCC-3 Reverse primer: 5-GGAAAAGCATTGAACACCCCAAGAGAAAGTAGTGACAAGTG-3 Alignment of the amino acid sequence of the mutant with the GFPuv amino acid sequence GFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60 mGFPuv MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTL 60 ************************************************************ GFPuv VTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 mGFPuv VTTFSWGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKDDGNYKTRAEVKFEGDTLV 120 *****:****************************************************** Y66W GFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 mGFPuv NRIELKGIDFKEDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGSVQLAD 180 ************************************************************ GFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238 mGFPuv HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK- 238 ********************************************************** Amino acid substitution: Y66W Belongs to Class 5, indole in chromophore (cyan fluorescent proteins) [6] eCFP CATATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 60 GFP ATGAGTAAAGGAGAAGAACTTTTCACTGGAGTTGTCCCAATTCTTGTTGAATTAGAT 57 ********************************************************* eCFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 120 GFP GGTGATGTTAATGGGCACAAATTTTCTGTCAGTGGAGAGGGTGAAGGTGATGCAACATAC 117 ************************************************************ eCFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 180 GFP GGAAAACTTACCCTTAAATTTATTTGCACTACTGGAAAACTACCTGTTCCATGGCCAACA 177 ************************************************************ eCFP CTTGTCACTACTTTCTCTTGGGGTGTTCAATGCTTTTCCCGTTATCCGGATCACATGAAA 240 GFP CTTGTCACTACTTTCTCTTATGGTGTTCAATGCTTTTCCCGTTATCCGGATCATATGAAA 237 ******************* ******************************** ****** Mutation eCFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 300 GFP CGGCATGACTTTTTCAAGAGTGCCATGCCCGAAGGTTATGTACAGGAACGCACTATATCT 297 ************************************************************ eCFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 360 GFP TTCAAAGATGACGGGAACTACAAGACGCGTGCTGAAGTCAAGTTTGAAGGTGATACCCTT 357 ************************************************************ eCFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 420 GFP GTTAATCGTATCGAGTTAAAAGGTATTGATTTTAAAGAAGATGGAAACATTCTCGGACAC 417 ************************************************************ eCFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 480 GFP AAACTCGAGTACAACTATAACTCACACAATGTATACATCACGGCAGACAAACAAAAGAAT 477 ************************************************************ eCFP GGAATCAAAGCT 492 GFP GGAATCAAAGCTAACTTCAAAATTCGCCACAACATTGAAGATGGATCCGTTCAACTAGCA 537 ************ eCFP GFP GACCATTATCAACAAAATACTCCAATTGGCGATGGCCCTGTCCTTTTACCAGACAACCAT 597 eCFP GFP TACCTGTCGACACAATCTGCCCTTTCGAAAGATCCCAACGAAAAGCGTGACCACATGGTC 657 eCFP GFP CTTCTTGAGTTTGTAACTGCTGCTGGGATTACACATGGCATGGATGAGCTCTACAAATAA 717 SDS-PAGE : Coomassie staining gel of (Sample 6): Marker GFP protein (soluble sample) Western blotting (Sample 11): Induced total sample GFP protein Ni-NTA chromatography: Fluorimetry: Mass spectrometry: Wild-type: Mutant: Discussion: Site-directed mutagenesis: In the site-directed mutagenesis mutation is carried out at the right place i.e., at 197 and 198 places. Tyrosine (TAT) is mutated to tryptophan (TGG), Y W. During this mutation protein undergoes many changes especially in the fluorescence. GFP turns into CFP (Cyan fluorescent protein) hence the light emitted will not be exactly green. CFP will have many peculiar features like rather than single excitation and emission peaks it possess double humping. Tag CFP possess some properties like: Structure monomer Molecular weight 27KDa Polypeptide length 239aa Fluorescence colour Cyan Maximum excitation 458nm Maximum emission 480nm Excitation coefficient 37000M-1 cm-1 Pka 4.7 Quantum yield 0.57 Brightness 21.1 Brightness is produced by the quantum yield and extinction coefficient. Dual colour visualisation of the protein expressed is enabled by the CFP. This has led to the Fluorescence Resonance Energy Development (FRET). SDS-PAGE: SDS-PAGE is carried out to separate proteins according to their electrophoretic mobility and experimental repeats will result in the purity assessment of the protein. Four wells are loaded with samples and 2 and 4 wells show protein result and as 1 and 3 wells dont contain protein they will be normal without any bands. Results shows that little amount of GFP has been observed in the insoluble and large amount of protein has been observed in the soluble sample. Uninduced sample cannot find GFP. Western-blotting: Western-blot is performed to make sure the presence of protein. Histidine tagged probe is added to confirm the protein present was GFP or not. pET28c plasmid contains T7 RNA polymerase promoter sequence. But this promoter is blocked by the repressor. Hence lactose containing medium is required for E.coli growth. Because lactose is used as carbon source, glucose is converted into allolactose. This allolactose will bind to repressor by unblocking promoter, and expresses GFP. Hence presence of glucose will result in Lac-I and is binds to the operator. Band observed in the blot is probably GFP and it has high level of intensity after induction. And it is necessary to confirm this by performing blotting technique using His probe to detect His tagged GFP. Bands are observed in the induced and soluble samples after performing western blotting confirming the presence of GFP. Ni-NTA chromatography: Purification of GFP can be done by Ni-NTA chromatography. For a recombinant protein the amino acid binding site with 6 or more His residues in a row acts as metal binding site. So hexa-his sequence is called as His-tag. His-tag sequence is present in the N-terminal of the target protein and is located in the promoter region adjacently to the GFP gene. During this process enzyme HRP is also bound to the probe. This HRP-probe will react with luminal 4 peroxidase buffer which is further used for purifying GFP by Ni-NTA chromatography. Purification by His-tagged GFP can be done by using several methods like Ni2+-poly (2 acetomidoacrylic acid) hydrogel. Displacement of GFP can be done by binding nickel to imidazole. This is mainly because of high affinity of nickel towards imidazole compared to GFP.Distinctive bands are supposed to observe in the elute1, elute 2 and also in the total soluble fraction. Bands formed states the presence of the GFP mutant. Absence of the bands states mutant a bsence. In the results bands are observed at the total induced and the soluble samples which state the protein presence. Even small amounts of bands are also observed in the insoluble sample. GFP protein produced in the induced total sample is approximately at 27KDa. Slight bands are observed in the insoluble sample as it may be because of some impurities. Finally the GFP protein has been detected. References: 1. Davenport D, Nichol JAC: Luminescence in Hydromedusae. Proceedings of the Royal Society, Series B 1955, 144:399-411 2. Ward. W., Prentice, H., Roth, A. Cody. C. and Reeeves.S.1982.Spectral perturbations of the Aequoria green fluorescent protein. Photochem. Photobiol. 35:803-808 3. Cormack, B. P., Valdivia, R. H., Falkow, S. (1996). FACS-optimized mutants of the green fluorescent protein (GFP). Gene, In press 4. Darelle Thomson , Greg Smith. (2001).PCR-based plasmid vector construction for generation of recombinant viruses. Journal of Virological Methods 94, 7-14 5. Vogelstein, B., and Gillespie, D. (1979) Preparative and analytical purification of DNA from agarose. Proc. Natl. Acad. Sci. USA 76, 615-619. 6. HEIM, R., PRASHER, D. C. TSIEN, R. Y. 1994. Wavelength Mutations and Posttranslational Autoxidation of Green Fluorescent Protein. Proceedings of the National Academy of Sciences of the United States of America, 91, 12501-12504. 7. HARUKI NIWA, SATOSHI INOUYE et,al., Chemical nature of the light emitter of the Aequorea green fluorescent protein. Vol. 93, pp. 13617-13622, November 1996. Proc. Natl. Acad. Sci. USA. 8. â€Å"Mass Spectrometry: A Foundation Course†, K. Downard, Royal Society of Chemistry, UK, 2004.

Mother Teresa Essay -- essays research papers

Biography Agnes Gonxha Bojaxhiu was born August 26, 1910 in Skopje, in Macedonia. Her childhood was comfortable and prosperous due to her father’s success. Her father encouraged his children to be generous and compassionate to those less fortunate. Her mother was very religious and she took the children to morning mass. Agnes often helped her mother deliver parcels of food and money to the poor and prayed with the whole family every evening. The family’s life changed dramatically after their father’s death, when Agnes was 9. Although now poor themselves, they continued to help those less fortunate. Christianity became increasingly important in Agnes’ life. From the age of 12, she was aware of a desire to devote her life to God. As Agnes thought about what she could do for Christ, she started to feel a call for God. In the two years she decided to become a nun. Agnes spent longer periods of time going on retreats and received guidance from her Father Confessor. At th e age of 17, she made the decision to become a nun, because she had been taught that chastity is a special and pure grace. This was an important moment for Agnes as she chose a life of self-sacrifice. Agnes was just 18 when she decided to join the Sisters of Our Lady of Loreto, who were very active in India. On December 1, 1928 the crossing to India started. In the beginning of 1929 they reached Colombo, then Madres and finally Calcutta. The journey continued to Darjeeling, where she completed her training. Agnes was trained in prayer, scriptures, theology, and the spirituality and history of her Order. She started to learn Hindi and Bengali and to improve her English. She taught at the local school and worked in a small medical station. On May 24, 1931, Agnes took her first vows of poverty, chastity and obedience as a sister of Loreto. She chose her name in religious life as St. Theresa of Lisieux. Soon after she went to Calcutta to begin her teaching career. She went to Loreto and for the next 19 years she lived the life of a Loreto nun and an educator of girls in a form of semi-enclosure. Her main subject was geography until she became head mistress. Whenever she left the compo und to teach at another school, she would see the slums. Calcutta was a deeply troubled city due to famine, floods and cyclones, which destroyed harvests and the number of beggars in search of food greatly increased. S... ...ers to â€Å"Give Christ to the world, do not keep him to yourself and in doing so use your hands.† Mother Teresa on the significance of death said â€Å"For me that is the greatest development of the human life, to die in peace and dignity, because that’s for eternity.† She is a Christian following in the footsteps of Jesus Christ. The heart of the Christian message is forgiveness, and in Mother Teresa’s own words â€Å"Without forgiveness there can be no real love.† She fully understood the Gospel of love; she practiced it with her whole heart, and through the daily toil of her hands. Through Mother Teresa’s work, many other charities were started. She had a dream, which became a reality. She provided a refuge of last resort for the dying when the alternative was to die alone on the street. The belief that God mandated Mother Teresa is shared by all of her Sisters. The way her life touched others particularly in the West, will probably be considered a far greater achievement than anything she did to change Calcutta. She devoted herself to helping the dying, the destitute, lepers, AIDS victims, orphans and society’s outcasts around the world because she saw in each person the human face of God.

Why Do People Talk About Others?

I have written my first essay. It took me hours and hours, and I just gave up. Please provide some constructive feedback. I know nothing beats practise, practise, practise, but some guide in the right direction would be muchly appreciated. Thanking in advise. Here goes: – We cannot control the evil tongues of others; but a good life enables us to disregard them. Cato the Elder (234 BC – 149 BC) There is so much good in the worst of us, And so much bad in the best of us, That it hardly behooves any of us To talk about the rest of us.Edward Wallis Hoch (1849 – 1925), Marion (Kansas) Record Never tell evil of a man, if you do not know it for certainty, and if you know it for a certainty, then ask yourself, ‘Why should I tell it? ‘ Johann K. Lavater A rumor without a leg to stand on will get around some other way. John Tudor Scandal is gossip made tedious by morality. Oscar Wilde (1854 – 1900), Lady Windermere's Fan, 1892, Act III Why do we talk ab out other people? Oscar Wilde's statement â€Å"Scandal is gossip made tedious by morality† shows something of the reason we talk about other people.Gossip relieves boredom. Gossiping carries such a negative connotation that few will proudly own to have done so, but few can say that they have not. Even John Tudor suggests that gossiping is a wide spread method of relieving boredom, when he said â€Å"A rumour without a leg to stand on will get around some other way. † For this reason, I somewhat agree with Cato the Elder's quote â€Å"We cannot control the evil tongues of others, but a good life enables us to disregard them. † For gossip is so common as to be navoidable. If gossip causes one discomfort, one will be living with discomfort all their life. Is it not a good life's phillosphy to accept this fact and not let other's ‘evil' tongue bother you? While accepting gossiping is a part of life, others attempt to advise us against gossiping. Edward Willis Hoch's quote† There is so much good in the worst of us, and so much bad in the best of us, that it hardly behooves any of us to talk about the rest of us. † suggests that there is not much point in gossiping.Also against gossiping is the the ‘think before you speak' phillosophy because as Tudor implies, rumour will spread and Lavater's â€Å"Why should I tell it? â€Å". These advice stem from the morality of giving respect for other's privacy, but they do not consider that the reason people gossip: the innate craving for learning, the comfort of having company and connection with other people. While some may say, there must be better things to learn about. Having company doesn't require talking about other people, there are other ways to connect. Yes, but why must we NOT talk about others?When talking about other people, we can: State facts: He has gone to London for a holiday. Give Opinion: They are married. What a bad match! Lie: She didn't do anything today! When we say facts, we are passing information. However, the same fact said can mean different things depending on the intent of the speaker. A child saying a by-passer is fat is simply stating an observation. Another person my say the same thing it to demean others. When we lie, it can be done with good intent. Thus it is the intent of the speaker that people are concerned about, not the gossip itself.It is through knowing one's action that one can learn from their mistakes, but one can only do so much! To learn from other's mistake is to not step in it yourself. If we do not talk about others, then one can only learn by doing things themshelves. Would this perhaps defeat the purpose of the education system? Does the benefit of learning not outweigh the intrusion into other's ‘privacy'? Not all gossip invades privacy. Gossip is a way people communicate, and learn. Gossip itself is not the immoral act, it is the intent of the gossiper that makes the act immoral or otherwise.

Bay Area Greats

San Francisco has been one of the most famous cities in the United States. It's spectacular views and sensational sights have captivated much of the population of the country and tourists around the world alike. There is an interesting point towards realizing the great history of San Francisco and the architecture of the city throughout the years. This paper serves to investigate the 1920s era of San Francisco's architecture. Most structures that were built during this decade was incorporated with the Art Deco style of architecture.ART DECO A popular international design movement from the 1920s and the 1930s, Art Deco affected the decorative arts such as interior design, industrial design, visual arts such as painting, graphic arts, fashion and film. But Art Deco's most effective implication was characterized through architecture. This style was, in a sense, a combination of many varying movements and styles of the early 20th century, just like the styles of Cubism, Constructivism, B auhaus, Modernism, Futurism, and Art Nouveau.During the 1920s, Art Deco's fame and notoriety reached its peak and strongly carried on in the United States up to the 1930s. Despite many design styles or movements being philosophical or political in nature, Art Deco was strictly decorative. During its peak, the Art Deco style was perceived as functional, modern, and elegant. The name of Art Deco was coined in after 40 years, exactly during the 1960s. It was derived from the 1925 Paris Exposition of Decorative Arts, where the style or movement's apex was reached.Characterized by thin, long forms, surfaces that are curving, and patterning that is geometric, Art Deco was a style that practitioners attempted to perceive as the appearance that they thought could express the machine age. Ranging from Skyscrapers to Ocean liners up to jewelry and even toasters, Art Deco is a style that influenced a good number of factors. Despite Art Deco's most famous structures such as the Rockefeller Cent er and the Chrysler Building being located in New York, a good number of Art Deco inspired structures can be found in the great bay area of San Francisco.It somehow dominated the area during the 1920s' insurgence of the style. SAN FRANCISCO ART DECO OF THE 1920s San Francisco was in a period of prosperity during the 1920s. It was hardly a decade of radical innovation. The city also pronounced the secondary phase in the construction of a higher and taller skyline that started to overshadow the buildings downtown that was Chicago-styled. George Kelham and Timothy Pflueger were San Francisco architects who followed the architects in Chicago and New York that designed skyscrapers. Art Deco was one European trend that did affect San Francisco during the 1920s.More focused on decorative than architectural style, Art Deco was inspired by cubist and abstract painting and an involvement in motifs that are ornamental and taken from locales that are exotic such as pre-Columbian Mexico, China, and ancient Egypt. This style brought a modern element to the design of American buildings, gearing the architects towards the path of utilizing longer, cleaner lines and surfaces that are more abstract in nature. SAMPLE BUILDING 1929, Financial District, Shell Building, 100 Bush St. , San Francisco. Designed by George Kelham.This building was defined as a Zig-zag Modern skyscraper. It has a thin, stepped tower clad in terra cotta that's colored rusticated beige. The forms of shells are properly integrated into the design despite being nearly out of sight–the shells that are projecting near the top hide lighting that turns the crown to gold occasionally. Carrying out the general them of the building is the entrance lobby. The Shell Building by George Kelham, designed in the Modern style of the 1920s, is a marvelous example of the former generation of skyscrapers.Kelham, one of the few graduates of the Ecole des Beaux-Arts who made major roles to local architecture, went to Sa n Francisco in the year 1906 to oversee construction of the Palace Hotel. He lived in the city, and his work on five major downtown structures pronounced the transition from the Chicago style to Modern structures. He is also attributed with changing the character of architects in the building of commercial structures by hiring a general contractor. Before general contractors were used, the architect had the responsibility for hiring laborers and getting materials.Just like Timothy Pflueger, Kelham's work was inspired both by New York architects who were lowering their structures due to to zoning laws passed during the year 1916 and by the entry of Eliel Saarienen in the 1922 Chicago Tribune Tower contest. As a matter of fact, the above area of the Shell Building closely looks like Saarinen's much-imitated design. George Kelham stressed verticality during a time when major structures rose 10 to 15 floors above their Chicago style counterparts. Definitely, Kelham's structures defined the upper limits of the downtown skyline during the 1920s.The structure's ornamentation shows a mixture of abstracted shell designs with Egyptian motifs, preferably the tower's lotus flowers. The Shell building was one of San Francisco's best Modern designs of the 1920s. It was described by the Architect and Engineer as possessing the central tower of the Russ Building, the penthouse of the Telephone Building, Gothic verticality, and its own definitive treatment of the eight upper floors. It was also described as a building that follows Eliel Saarinen's Chicago Tribune Tower Competition model entry.The ornamentation of the Shell Building was also incorporated with â€Å"Egyptian ancestry and with a modernistic flare†. It includes an elaborate design of abstracted shells, an incorporation with the owner of the building. The tower's upper part with its ornamental concentration, was dramatically original with floodlight at night. The interior of the building also carried ornamen tal detail, including the building lobby, all elevator lobbies, and the offices of the executives. Designed with movable partitions were the office floors.The building's greatness can also be concluded with its record-breaking time of completion. The whole structure was also constructed using Steel frame construction. Today, it remains as one of San Francisco's most distinctive business addresses. The Shell building won the 1994 San Francisco Architectural Heritage Award for the excellence in architectural preservation. It was defined as a building strongly influenced by Art Deco and its founding father which is George Kelham. The Shell Building with its time-honored architecture, contemporary offices and classic amenities-has captured the best of both worlds.It is a San Francisco landmark. CONCLUSION San Francisco's Art Deco style during the 1920s has produced inspiring works of architecture up to today. The dominance of the Art Deco style in the 1920s helped San Francisco in turni ng around and becoming as one of the most popular places in the United States. The Shell Building for example, has created a great sense of fame and popularity due to the Art Deco influence. San Francisco and Art Deco somehow seemed fit for each other and as one tours San Francisco, the Art Deco style is one style that mostly captivates the eyes.

Musical Moulin Rouge Characters, Songs & Song & Storey essays

Musical Moulin Rouge Characters, Songs & Song & Storey essays Moulin Rouge is about a show girl Satin wanting to be a actress The songs were set from 1900 to todays music. They sang songs such as "Diamonds are a girls best friend", "mature boy", "complainte de la butte", "children of the revolution", "the sound of music", "zidlers rap", "lady marmalade", "mature girl", "skills like lee spirit", "because we can", "rhythm of the sight", "diamond dogs", "one day i'll fly away", "fool to be", "roxanne". Satin singing 5 duets. The stars are Nicole Kidman, Ewan Magreeger. It is all about love but Satin is not aloud to fall in love but she did. Theres no laws, no limits just one rule dont fall in love. The writer makes a storey which the duke producers. The night of your dreams was "Moulin Rouge". Meanwhile satin was dieingshe treied to break it off with Christine but they loved each other to much. She had to break it of as she wasn't aloud relationships. Christine was going to get killed if he was anywhere near Satin but he ahd no idea he could get killed. He goes to her preformance just to see if she was lieing about not loving him. Only for her to die at the performance of amphacemia. ...

Water Pollution and Global Warming Essay Example

Water Pollution and Global Warming Essay Example Water Pollution and Global Warming Paper Water Pollution and Global Warming Paper Essay Topic: Water pollution As a result it plays important roles in ecosystem support, economic development, cultural values and community well-being. Dozens of times a day those of us who live in the industrialized nations of the world enjoy a blessing denied to 75 percent of the world population: abundant supplies of clean water. But water is essential for life on earth. No known organisms can live without it. For centuries water has been used as a dumping ground for human sewage and industrial wastes. Added to them are the materials leached out and transported from and by water percolating through the soil and running off its surface to aquatic ecosystems. Water pollution is degradation of water quality. Any physical, chemical, or biological change in water quality that adversely affects living organisms or makes water unsuitable for desired use can be considered pollution. Thus the term water pollution refers to Water contamination by a variety of chemical substances or transportation caused by several nutrients and fertilizers. Southwest, 1 976 U. S. Department of Health Education and Welfare defines water pollution as The adding to water of any substance or he changing of waters physical and chemical characteristics in any way which interferes with its use of legitimate purposes. At present, water pollution is a major global problem. Everyday many people are dying for water pollution. Now water pollution becomes the leading cause of death diseases. 3 1. 2 Sources of Water Pollution : There are many sources of water pollution. But before knowing that, we need to know that what are the sources of water, and then we will understand how they are becoming polluted. We get water from two sources Surface Water Ground Water Surface Water is fresh water mound on Earths surface in streams and rivers, lakes, ponds, reservoirs. Surface waters are replenished by the runoff of precipitation from the land and are therefore considered a renewable, although finite resource. Ground Water refers to the fresh water under Earths surface that is stored in aquifers. This water originates as rain or melting snow that seeps into the soil and finds its way down through cracks and spaces in sand, gravel or rock until it is stopped by an impenetrable layer, there it accumulates as groundwater. Surface water and groundwater have often been studied and managed as operate resources, although they are interrelated. Surface water seeps through the soil and becomes groundwater. Conversely, groundwater can also feed surface water sources. Sources of surface water pollution are generally grouped into two categories based on their origin. Point Sources Nons of sources in this category include discharges from a sewage treatment plant, a factory, or a city storm drain. Point source water pollution re easily findable. So, people can easily control them. Non-point source pollution refers to diffuse contamination that does not originate from a single discrete source. Non-point source pollution is often the cumulative effect of small amounts of contaminants gathered from a large area. A common example is the leaching out of nitrogen compounds from fertilized agricultural lands. Nutrient runoffs in storm water from sheet flow over an agricultural field or a forest are also cited as examples of Non-point source pollution. 4 Surface Water Pollution : Surface water bodies are extensively used for espousal of untreated industrial wastes and this is one of the main sources of surface water pollution. Surface water pollution is caused by C Domestic Waste : Water pollution Of domestic is mainly caused by sewage. Sewage is defined as the waterborne waste derived from home, animal or food processing plants and includes human excreta, soaps, organic materials, different types of solids, waste food, oil detergents, paper and cloth. They are the largest group of water pollutants. Water pollution is caused by uncontrolled dumping of waste collected from villages, towns and cities into ponds, streams, lakes and rivers. C] Industrial Effluent : The discharge of industrial effluents into the water body caused water pollution. These effluents contain a wide variety of inorganic and organic substances such as oils, greases, plastics, plasticizer, metallic wastes, suspended solids, phenols, pesticides, heavy metals and acids. Major industries of the country are located on or near the coastline or riversides. Organic substances deplete the oxygen content. Inorganic substances render the water unfit for drinking and other purposes. Acids and alkalis adversely effect the growth of fish and other aquatic organisms. Oil and other greasy substances interfere with the self purification mechanism of water. Urban runoff : Urban runoff is surface runoff of rainwater created by arbitration. This runoff is one of the major sources of water pollution in many urban communities worldwide. The porous and varied terrain of natural landscapes like forests, wetlands, and grasslands trap rainwater and snowbell and allow it to slowly filter into the ground. Runoff tends to reach receiving waters gradually. In contrast, nonporous urban landscapes like roads, bridges, parking lots, and buildings dont let runoff slowly percolate into the ground Arbitration also increases the variety and amount of pollutants transported to receiving waters. Sediment from development and new construction; Oil, grease, and toxic chemicals from automobiles; nutrients and pesticides from turf management and gardening; viruses and bacteria from failing septic systems; road salts; and heavy metals are examples of pollutants generated in urban areas. Sediments and solids constitute the largest volume of pollutant loads to receiving waters in urban areas. Ã'Å¡ Agricultural runoff : Water pollution can be caused by agricultural wastes such as fertilizers, pesticides, soil additives and animal wastes that are washed off from the land to the aquatic system through irrigation, rainfall and leaching. Oil pollution : There are about 15 million water crafts on navigable waters throughout the world. Their combined waste discharges are equivalent to a city with a population of 2,000,000. Thus oil pollution, an oxygen demanding Waste, is of concern not only from sensational major spills from ships and offshore drilling rigs but also from small spills and cleaning operations. Al Chemical Use : Industrial and agricultural work involves the use of many different chemicals that can run-off into water and pollute it. It can also cause health hazards to human body and many animals and fishes are dying for these chemicals. CLC Thermal Pollution : An increase in the optimum water temperature by industrial processes (steel factories, electric power houses and atomic power plants) may be called as thermal pollution. Many industries generate their own power and use water to cool their generators. This hot water is released into the system from where it was drawn, causing a warming trend of surface waters. Fifth system is poorly flushed, a permanent increase in the temperature may result. However, if the water is released into he well flushed systems, permanent increase in temperature does not occur. Many organisms are killed instantly by the hot water resulting into a high mortality. It may bring other disturbance in the ecosystem. The eggs of fish may hatch early or fail to hatch at all. It may lead to unplanned migration of aquatic animals. D Sediments : Sediment is defined as particles derived from soil or rocks that are transported by water or wind. The erosion of land surfaces and stream banks produces sediment. Sediment threatens water supplies and recreation and cause harm to plant and fish communities. Sediment can also be discharged from multiple different sources. Sources include construction sites agricultural fields, stream banks, and highly disturbed areas. D Salinity Intrusion : Saltwater intrusion is a major problem in coastal regions all over the world, as it threatens the health and possibly lives Of many people who live in these areas. It increases the salinity of groundwater and water may become unsuitable for human use. Colonization of groundwater is considered a special category of pollution that threatens groundwater resources, because mixing a small quantity of saltwater in the rainwater makes freshwater unsuitable and can result in abandonment of freshwater supply. CLC Accidental Spills of Chemicals : Accidental spills of environmentally harmful materials can happen anywhere and anytime, polluting land and water. Even echo-friendly cleaners and chemicals can harm the fish, plants and insects in our streams and harbors, if they are washed into stemware drains. 6 Ground Water Pollution : A lot of the Earths water is found underground in soil or under rock structures called aquifers. Humans often use aquifers as a means to obtain drinking water, and build wells to access it. When this water becomes polluted it is called groundwater pollution. Groundwater pollution is often caused by pesticide contamination from the soil, this can infect Our drinking water and cause huge problems. Ground water pollution caused BBC Waste disposal site : Domestic and industrial wastes are collected to dispose them in a place. There are many chemicals which are found in these wastes. The places where these waste are disposed become polluted. If the place has a leak and it lead to the nearby river, then by the leaks, the chemicals go to the river and make the river polluted. D Pesticides : Run-off from farms, skyward, and golf courses contain pesticides such as EDT that in turn contaminate the water. Leech ate from landfill sites is another major contaminating source. Its effects on the ecosystems and health are endocrine and reproductive damage in wildlife. Groundwater is susceptible to contamination, as pesticides are mobile in the soil. It is a matter of concern as these chemicals are persistent in the soil and water. L] Sewage : Untreated or inadequately treated municipal sewage is a major source of groundwater and surface water pollution in the developing countries. The organic material that s discharged with municipal waste into the watercourses uses substantial oxygen for biological degradation thereby upsetting the ecological balance of rivers and lakes. Sewage also carries microbial pathogens that are the cause of the spread of disease. C Nutrients : Domestic waste water, agricultural run- off, and industrial effluents contain phosphorus and nitrogen, fertilizer run- off, manure from livestock operations, which increase the level of nutrients in water bodies and can cause transportation in the lakes and rivers and continue on to the coastal areas. The nitrates come mainly from the fertilizer hat is added to the fields. Excessive use of fertilizers cause nitrate contamination Of groundwater, with the result that nitrate levels in drinking water is far above the safety levels recommended. Good agricultural practices can help in reducing the amount of nitrates in the soil and thereby lower its content in the water. 7 Acidification : Acidification of surface water, mainly lakes and reservoirs, is one of the major environmental impacts of transport over long distance of air pollutants such as sulfur dioxide from power plants, other heavy industry such as steel plants, and motor vehicles. This problem is more severe in the US and in parts of Europe. C] Synthetic organics : Many of the 100 DO synthetic compounds in use today are found in the aquatic environment and accumulate in the food chain. Persistent organic pollutants represent the most harmful element for the ecosystem and for human health. For example, industrial chemicals and agricultural pesticides. These chemicals can accumulate in fish and cause serious damage to human health. Where pesticides are used on a large-scale, groundwater gets contaminated and this leads to the chemical contamination of drinking water. Ã'Å¡ Arsenic Problem : Most arsenic enters water supplies either from natural deposits in the earth or from industrial and agricultural pollution. Arsenic is a natural element of the earths crust. It is used in industry and agriculture and for other purposes. It also is a byproduct of copper smelting, mining and coal burning. C Suspended Matter : Some pollutants do not dissolve in water as their molecules are too big to mix between the water molecules. This material is called particulate matter and can often be a cause of water pollution. The suspended particles eventually settle and cause thick silt at the bottom. This s harmful to marine life that lives on the floor of rivers or lakes. Biodegradable substances are often suspended in water and can cause problems by increasing the amount of anaerobic microorganisms present. Toxic chemicals suspended in water can be harmful to the development and survival of aquatic life. 8 1. 3 Common Contaminants of Water Pollution : There are some contaminants of water pollution. They are C Infectious Agents : Disease causing agents or pathogens, including bacteria, viruses, protozoa, parasites. These come from raw sewage and animal waste and they may be responsible for 80% of the asses in developing countries. CLC Oxygen demanding wastes : Reduce Dissolved Oxygen level in the water and affect aquatic life. Sewage, animal manure or biodegradable organic wastes are that type of waste. 0 Inorganic chemicals : Water-soluble acids, toxic compound, salt and metals are the inorganic chemicals. They make water unfit to consume and use for irrigation. Also can harm organisms and cause material corrosion. D Organic chemicals : Organic chemicals are petroleum products, oil, gasoline, plastics, pesticides, solvents, detergents. Presence of organic chemicals in water cause health kiss to humans and other organisms. Ã'Ëœ Plant nutrients : Nitrates, phosphates, ammonium from fertilizers are plant nutrients. Excessive algal and plant growth lower the oxygen levels when they decompose. Sediment : Sediments are bad for aquatic animals. Mud, silt, sand are the example. Sediment disrupts photosynthesis and transports large amounts of other adsorbed pollutants. Sediments are bad for Aquatic animals. D Radio-ac tive materials : Radon, uranium, Iodine, cesium, thorium, and tritium are the radio-active materials. These materials may come either from natural or anthropogenic sources. Heat : Heat comes from cooling water for power plants other industrial plants. Heat lowers the solubility of oxygen in water and it also affects aquatic lives directly. 9 1. 4 Health Hazards Caused by Water Pollution : Virtually all types of water pollution are harmful to the health of humans and animals. Water pollution may not damage our health immediately but can be harmful after long term exposure. Different forms of pollutants affect the health of animals in different ways. Such as Heavy metals from industrial processes can accumulate in nearby lakes and rivers. These are toxic to marine life such as sis and shellfish, and subsequently to the humans who eat them. Heavy metals can slow development; result in birth defects and some are carcinogenic. Industrial waste often contains many toxic compounds that damage the health of aquatic animals and those who eat them. Some of the toxins in industrial waste may only have a mild effect whereas other can be fatal. They can cause immune suppression, reproductive failure or acute poisoning. Microbial pollutants from sewage often result in infectious diseases that infect aquatic life and terrestrial life through drinking water. Microbial water pollution is a major problem in the developing world, with diseases such as cholera and typhoid fever being the primary cause of infant mortality. Organic matter and nutrients causes an increase in aerobic algae and depletes oxygen from the water column. This causes the suffocation of fish and other aquatic organisms. Sulfate particles from acid rain can cause harm the health of marine life in the rivers and lakes it contaminates, and can result in mortality. Suspended particles in freshwater reduces the quality of drinking water for humans and the aquatic environment for marine life. Suspended particles can often reduce the amount of sunlight penetrating the water, disrupting the growth of photosynthetic plants and micro-organisms. There are some water borne diseases of human which caused by drinking or using polluted water. They are given pillowcase Bacterial infections Viral infections Protozoan infections Hellishness infection Diseases Typhoid, cholera, Paratyphoid fever, Dysentery Infectious Hepatitis (jaundice), Poliomyelitis Amoebic dysentery Roundworm, Hookworm, threadbare 10 2. 0 Global Warming 2. What is Global Warming : Global warming is defined s a natural or human induced increase in the average global temperature of the atmosphere near the Earths surface. The temperature at or near the surface of the Earth is determined by four main factors : ; ; ; ; The amount of sunlight Earth receives. The amount of sunlight Earth reflects. Retention of heat by the atmosphere. Evaporation and condensation of water vapor. In the last 100 years, Earths average surfa ce temperature increased by about 0. 8 co (1. 4 OF). Two thirds of the increase occurred over the last three decades. Warming of the climate system is unequivocal. Scientists are more Han 90% certain that most of it is caused by increasing concentrations of greenhouse gases produced by human activities. These findings are recognized by the national science academies of all the major industrialized countries. 11 2. 2 Causes of Global Warming : Scientists have spent decades figuring out what is causing global warming. Theyve looked at the natural cycles and events that are known to influence climate. But the amount and pattern of warming thats been measured cant be explained by these factors alone. The only way to explain the pattern is to include the effect of greenhouse gases emitted by humans. There are many natural causes of global warming. But they do not warm much the planet. The most serious type of warm is anthropogenic which is created by humans. One of the first things scientists learned is that there are several greenhouse gases responsible for warming and humans emit them in a variety of ways. The causes of global warming are given below -? Greenhouse Gases : Sunlight that reaches Earth warms both the atmosphere and the surface. Earths surface and atmospheric system then irradiate heat as infrared radiation. Certain gases in Earths atmosphere absorb and re-emit this radiation. Some of it returns to the Earth ;s surface, making Earth warmer than it otherwise would be. In trapping heat, the gases act a little like the panes of glass in a greenhouse (although the process by which the heat is trapped is not the same as in a greenhouse), accordingly, the effect is called the greenhouse effect, and the gases which include Water vapor, carbon dioxide, methane, and chlorofluorocarbons (CIFS) are called greenhouse gases. Extra Carbon Dioxide Release : Human are releasing Carbon dioxide in the environment by burning fossil fuels, burning trees, driving cars and from the industry. This excessive carbon dioxide is not absorbed by the environment. This makes our planet warmer and the result is global warming. CLC Methane Gas from animals, agriculture, Arctic Sea beds: Methane is another extremely potent greenhouse gas, r anking right behind CO. When organic matter is broken down by bacteria under oxygen-starved conditions (anaerobic decomposition) as in rice paddies, methane is produced. The process also takes place in the intestines of herbivorous animals and with the increase in the amount of concentrated livestock production, the levels of methane released into the atmosphere is increasing. Another source of methane is methane celebrate, a compound containing large amounts of methane trapped in the crystal structure of ice. As methane escapes from the Arctic sea beds, the rate of global warming will increase significantly. 12 0 Solar Variation : Variations in solar output have been the cause of past climate changes. The effect Of changes in solar forcing in recent decades is uncertain but small. Some studies showing a slight cooling effect while others studies suggest a slight warming effect. C] Nitrogen Oxides from Farming : Primary component of the green revolution has been the development of iatrogenic fertilizers that dramatically accelerate the growth and productivity of plants in the field. Plants fix or capture, nitrogen on their own as well but green revolution technologies have become so popular that humans are now adding more nitrogen to the earth than all of the plants in the world combined. Nitrogen oxides have 300 times more heat-trapping capacity per unit of volume than does carbon dioxide and we release them every time we apply fertilizer to soil. A recent United Nations Food and Agriculture Organization study found that modern farming is contributing more to global arming than all of the transportation sector combined. This is due partly to the fuel burned in modern farming, but more significantly, to the release of methane and nitrogen oxides. C] Chlorofluorocarbon (CUFF) Gas : Chlorofluorocarbons (CUFF), is used in refrigeration, also powerful greenhouse gas. These gas occur in lower concentrations in the atmosphere, but because they are so much more potent than carbon dioxide, in some cases hundreds of times more potent per unit of volume, they contribute to global warming as well. CLC Deforestation Deforestation increases the severity of global arming as well. Carbon dioxide is released from the human conversion of forests and grasslands into farmland and cities. All living plants store carbon. When those plants die and decay, carbon dioxide is released back into the atmosphere. As forests and grasslands are cleared for human use, enormous amounts of stored carbon enter the atmosphere. Burning Gasoline for transportation : Our modern car culture and appetite for globally sourced goods is responsible for about 33% of emissions in the U. S. With our population growing at an alarming rate, the demand for more cars and nonuser goods means that we are increasing the use of fossil fuels for transportation and manufacturing.

The Archaeology and History of Bitumen

The Archaeology and History of Bitumen Bitumen- also known as asphaltum or tar- is a black, oily, viscous form of petroleum, a naturally-occurring organic byproduct of decomposed plants. It is waterproof and flammable, and this remarkable natural substance has been used by humans for a wide variety of tasks and tools for at least the past 40,000 years. There are a number of processed types of bitumen used in the modern world, designed for paving streets and roofing houses, as well as additives to diesel or other gas oils. The pronunciation of bitumen is BICH-eh-men in British English and by-TOO-men in North America. What Bitumen Is Natural bitumen is the thickest form of petroleum there is, made up of 83% carbon, 10% hydrogen and lesser amounts of oxygen, nitrogen, sulfur, and other elements. It is a natural polymer of low molecular weight with a remarkable ability to change with temperature variations: at lower temperatures, it is rigid and brittle, at room temperature it is flexible, at higher temperatures bitumen flows. Bitumen deposits occur naturally throughout the worldthe best known are Trinidads Pitch Lake and the La Brea Tar Pit in California, but significant deposits are found in the Dead Sea, Venezuela, Switzerland, and northeastern Alberta, Canada. The chemical composition and consistency of these deposits vary significantly. In some places, bitumen extrudes naturally from terrestrial sources, in others it appears in liquid pools which can harden into mounds, and in still others it oozes from underwater seeps, washing up as tarballs along sandy beaches and rocky shorelines. Uses and Processing In ancient times, bitumen was used for a huge number of things: as a sealant or adhesive, as building mortar, as incense, and as decorative pigment and texture on pots, buildings or human skin. The material was also useful in waterproofing canoes and other water transport, and in the mummification process toward the end of the New Kingdom of ancient Egypt. The method of processing bitumen was nearly universal: heat it until the gasses condense and it melts, then add tempering materials to tweak the recipe to the proper consistency. Adding minerals such as ochre makes bitumen thicker; grasses and other vegetable matter add stability; waxy/oily elements such as pine resin or beeswax make it more viscous. Processed bitumen was more expensive as a trade item than unprocessed, because of the cost of the fuel consumption. The earliest known use of bitumen was by Middle Paleolithic Neanderthals some 40,000 years ago. At Neanderthal sites such as Gura Cheii Cave (Romania) and Hummal and Umm El Tlel in Syria, bitumen was found adhering to stone tools, probably to fasten a wooden or ivory haft to the sharp-edged tools. In Mesopotamia, during the late Uruk and Chalcolithic periods at sites such as Hacinebi Tepe in Syria, bitumen was used for the construction of buildings and water-proofing of reed boats, with among other uses. Evidence of Uruk Expansionist Trade Research into bitumen sources has illuminated the history of the expansionist period of Mesopotamian Uruk. An intercontinental trading system was established by Mesopotamia during the Uruk period (3600-3100 BC), with the creation of trading colonies in what is today southeastern Turkey, Syria, and Iran. According to seals and other evidence, the trade network involved textiles from southern Mesopotamia and copper, stone, and timber from Anatolia, but the presence of sourced bitumen has enabled scholars to map out the trade. For example, much of the bitumen in Bronze age Syrian sites has been found to have originated from the Hit seepage on the Euphrates River in southern Iraq. Using historical references and geological survey, scholars have identified several sources of bitumen in Mesopotamia and the Near East. By performing analyses using a number of different spectroscopy, spectrometry, and elemental analytical techniques, these scholars have defined the chemical signatures for many of the seeps and deposits. Chemical analysis of archaeological samples has been somewhat successful in identifying the provenance of the artifacts. Bitumen and Reed Boats Schwartz and colleagues (2016) suggest that the onset of bitumen as a trade good began first because it was used as waterproofing on the reed boats that were used to ferry people and goods across the Euphrates. By the Ubaid period of the early 4th millennium BC, bitumen from northern Mesopotamian sources reached the Persian Gulf. The earliest reed boat discovered to date was coated with bitumen, at the site of H3 at As-Sabiyah in Kuwait, dated about 5000 BC; its bitumen was found to have come from the Ubaid site of Mesopotamia. Asphaltum samples from the slightly later site of Dosariyah in Saudi Arabia, were from bitumen seepages in Iraq, part of the wider Mesopotamian trade networks of Ubaid Period 3. The Bronze Age Mummies of Egypt The use of bitumen in embalming techniques on Egyptian mummies was important beginning at the end of the New Kingdom (after 1100 BC)in fact, the word from which mummy is derived mumiyyah means bitumen in Arabic. Bitumen was a major constituent for Third Intermediate period and Roman period Egyptian embalming techniques, in addition to traditional blends of pine resins, animal fats, and beeswax. Several Roman writers such as Diodorus Siculus (first century BC) and Pliny (first century AD) mention bitumen as being sold to Egyptians for embalming processes. Until advanced chemical analysis was available, black balms used throughout the Egyptian dynasties were assumed to have been treated with bitumen, mixed with fat/oil, beeswax, and resin. However, in a recent study Clark and colleagues (2016) found that none of the balms on mummies created prior to the New Kingdom contained bitumen, but the custom began in the Third Intermediate (ca 1064-525 BC) and Late (ca 525-332 BC) periods and became most prevalent after 332, during the Ptolemaic and Roman periods. Bitumen trade in Mesopotamia continued well after the end of the Bronze Age. Russian archaeologists recently discovered a Greek amphora full of bitumen on the Taman peninsula on the northern shore of the Black Sea. Several samples including numerous large jars and other objects were recovered from the Roman-era port of Dibba in the United Arab Emirates, containing or treated with bitumen from the Hit seepage in Iraq or other unidentified Iranian sources. Mesoamerica and Sutton Hoo Recent studies in pre-Classic and post-classic period Mesoamerica have found bitumen was used to stain human remains, perhaps as a ritual pigment. But more likely, say researchers Argez and associates, the staining may have resulted from using heated bitumen applied to stone tools which were used to dismember those bodies. Fragments of shiny black lumps of bitumen were found scattered throughout the 7th-century ship burial at Sutton Hoo, England, in particular within the burial deposits near remains of a helmet. When excavated and first analyzed in 1939, the pieces were interpreted as Stockholm tar, a substance creating by burning pine wood, but recent reanalysis (Burger and colleagues 2016) has identified the shards as bitumen having come from a Dead Sea source: very rare but clear evidence of a continuing trade network between Europe and the Mediterranean during the early Medieval period. Chumash of California In Californias Channel Islands, the prehistoric period Chumash used bitumen as body paint during curing, mourning and burial ceremonies. They also used it to attach shell beads onto objects such as mortars and pestles and steatite pipes, and they used it for hafting projectile points to shafts and fishhooks to cordage. Asphaltum was also used for waterproofing basketry and caulking sea-going canoes. The earliest identified bitumen in the Channel Islands so far is in deposits dated between 10,000-7,000 cal BP at Cave of the Chimneys on San Miguel island. The presence of bitumen increases during the Middle Holocene (7000-3500 cal BP and basketry impressions and clusters of tarred pebbles show up as early as 5,000 years ago. The fluorescence of bitumen may be associated with the invention of the plank canoe (tomol) in the late Holocene (3500-200 cal BP). Native Californians traded asphaltum in liquid form and hand-shaped pads wrapped in grass and rabbit skin to keep it from sticking together. Terrestrial seeps were believed to produce a better quality adhesive and caulking for the tomol canoe, while tarballs were considered inferior. Sources Argez C, Batta E, Mansilla J, Pijoan C, and Bosch P. 2011. The origin of black pigmentation in a sample of Mexican prehispanic human bones. Journal of Archaeological Science 38(11):2979-2988.Brown KM. 2016. Asphaltum (bitumen) production in everyday life on the California Channel Islands. Journal of Anthropological Archaeology 41:74-87.Brown KM, Connan J, Poister NW, Vellanoweth RL, Zumberge J, and Engel MH. 2014. Sourcing archaeological asphaltum (bitumen) from the California Channel Islands to submarine seeps. Journal of Archaeological Science 43:66-76.Burger P, Stacey RJ, Bowden SA, Hacke M, and Parnell J. 2016. Identification, Geochemical Characterisation and Significance of Bitumen among the Grave Goods of the 7th Century Mound 1 Ship-Burial at Sutton Hoo (Suffolk, UK). PLoS ONE 11(12):e0166276.Cà ¢rciumaru M, Ion R-M, Nitu E-C, and Stefanescu R. 2012. New evidence of adhesive as hafting material on Middle and Upper Palaeolithic artefacts from Gura Cheii-Rà ¢snov Cave (Romania ). Journal of Archaeological Science 39(7):1942-1950. Clark KA, Ikram S, and Evershed RP. 2016. The significance of petroleum bitumen in ancient Egyptian mummies. Philosophical Transactions of the Royal Society A: Mathematical, Physical and Engineering Sciences 374(2079).El Diasty WS, Mostafa AR, El Beialy SY, El Adl HA, and Edwards KJ. 2015. Organic geochemical characteristics of the Upper Cretaceous–Early Paleogene source rock and correlation with some Egyptian mummy bitumen and oil from the southern Gulf of Suez, Egypt. Arabian Journal of Geosciences 8(11):9193-9204.Fauvelle M, Smith EM, Brown SH, and Des Lauriers MR. 2012. Asphaltum hafting and projectile point durability: an experimental comparison of three hafting methods. Journal of Archaeological Science 39(8):2802-2809.Jasim S, and Yousif E. 2014. Dibba: an ancient port on the Gulf of Oman in the early Roman era. Arabian Archaeology and Epigraphy 25(1):50-79.Kostyukevich Y, Solovyov S, Kononikhin A, Popov I, and Nikolaev E. 2016. The investigation of the bitumen from anc ient Greek amphora using FT ICR MS, H/D exchange and novel spectrum reduction approach. Journal of Mass Spectrometry 51(6):430-436. Schwartz M, and Hollander D. 2016. The Uruk expansion as dynamic process: A reconstruction of Middle to Late Uruk exchange patterns from bulk stable isotope analyses of bitumen artifacts. Journal of Archaeological Science: Reports 7:884-899.Van de Velde T, De Vrieze M, Surmont P, Bodà © S, and Drechsler P. 2015. A geochemical study on the bitumen from Dosariyah (Saudi-Arabia): tracking Neolithic-period bitumen in the Persian Gulf. Journal of Archaeological Science 57:248-256.Wess JA, Olsen LD, and Haring Sweeney M. 2004. Asphalt (Bitumen). Concise International Chemical Assessment Document 59. Geneva: World Health Organization.

Business law Cases Case Study Example | Topics and Well Written Essays - 500 words

Business law Cases - Case Study Example Since the Thai man had bought the books from the publishers, he therefore reserves the right to resell them, an argument which acquitted him from the allegations. The rule exists to protect both publishers and consumers from exploitations by either party. 3. The publishers who were the plaintiff in the case argued that they did not permit the sale of the books in the United States of America, an argument supported by other publishers. However, they fail to recognize that the Thai man had bought the books from the countries thereby purchasing the rights as well allowing him to resell the books wherever he felt like as he did. 4. The defendant produces the receipt of his actual initial purchase of the books from the developing country and argues that after buying the books, he reserves the right to gain financial benefit from them through resale as the first sale rule permits. The effects of the decision are likely to encourage second hand purchase of books thereby denying publishers of financial benefits (Brent 1). 5. The outcome of the ruling is more likely to encourage resale of books thereby encouraging more students to show preference to the second hand books instead of buying new books from bookshops and the publishers. The fact that resale transfers the rights to the new owners, students may also later sell such materials implying that the decisions will result in the recycle of books. 6. The facts in the case are likely to have ripple effects and affect businesses in the world. Currently the technological advancements enables ease of reproduction of materials making resale easier a fact that may encourage reproduction and resale of such material a fact that is likely to affect publishing businesses now than it did in the past. The owner of both the dog and the truck left both unattended, which is a major fact and a key determinant on the case. The predictability of the case results in injury of the victim a fact that compels the owner of both

Order and Good vs Chaos and Evil in a Moral Perceptive Assignment

Order and Good vs Chaos and Evil in a Moral Perceptive - Assignment Example These two types of alignments give the extremities for every society. This is why each society must have a set of rules to govern the code of conduct. Law in a society is an indication that everything should follow a specific order and the opposite of this is chaos. G- The Station, February 20, 2003, West Warwick, Rhode Island is regarded as one of the deadliest nightclub fires that killed about 100 people. The fire was caused by pyrotechnics that ignited flammable sound insulation foam in the ceilings and walls. C- The first 72 hours following the landfall of Hurricane Katrina in New Orleans, Louisiana. This is regarded as the deadliest and destructive Atlantic hurricane. At least 1,833 people died and property worth $ 81 million was destroyed. D -New Year’s Eve, Times Square, New York City, New York. This is a date where people all over the world to admire the dazzling lights from the Times Square. It is a symbolic center of this city and regarded as a global tradition. H- Kiss, January 27, 2013, Santa Maria, Brazil this was a fire that started between 2:00 and 2:30 that killed at least 239 and injured 169. It is regarded as the most devastating fire disaster in the history of Brazil. A- The execution of Timothy Mc Veigh – Timothy Mc Veigh was a domestic terrorist who detonated a truck bomb in Oklahoma city that killed 168 people and injured over 800. It is one of the deadliest act of terrorism within the United  States.

Personal Philosophy of Education Essay Example | Topics and Well Written Essays - 2750 words

Personal Philosophy of Education - Essay Example While the worldviews of monotheists and polytheists are also substantially different from each other, yet they are similar at least to the extent that both believe in the existence of an other world that is beyond the reach and sight of the human beings for a certain time. Religion happens to be the main source of guidance and influence in terms of worldview because it provides the most radical and sensible explanation of what life is all about. Metaphysics  Since I believe in God, I believe that whatever I do in this world will have an impact on what I get in the world hereafter. My future in the world hereafter depends upon my performance in this world; the extent to which I remain noble, just, and fair will depict whether I deserve reward or punishment as a result of my deeds in the world hereafter. The concept of the impact of the deeds performed in this world upon the life hereafter motivates me to be good to others and sacrifice many pleasures in this world. The profession of teaching in this perspective is a very noble profession in that it provides me with the opportunity to spread knowledge and light in the society, to empower the society by empowering the students and particularly the young generation from the standpoint of knowledge as well as morally. This is a just and respectable way of earning money because an individual gets to contribute positively to the society in compensation. My worldview implies that I do my duty with uttermost honesty and sincerity.

Security Case Study Example | Topics and Well Written Essays - 1500 words

Security - Case Study Example Computers had literally made the task of computing very fast and ultra accurate; people expect results within minutes or seconds. Scientific, medical, and technological progress had been achieved with the use of all the computer technologies currently available, accelerating human advancement by several degrees if compared to the prior centuries and millennia before the advent of computers. Other areas of human endeavors have likewise benefited from this computer-related development such as in the business and industry sectors, in the telecommunications, banking, trading and commerce sectors as well as in almost all aspects of human life. Today, there is no escaping the fact of interacting with computer-related equipment as people go along their lives in their daily activities. Computers are used in various ways wherein people may not be aware of, like in a building with a computer-controlled air conditioning system, using an elevator or an escalator, trying to get in touch with thei r friends, acquaintances, and relatives through social media sites, to buy a product or service on-line through electronic commerce (e-commerce), and get the news or entertainment from the Internet. This paper focuses on one such aspect, which is the human-computer interface (HCI) that is at the basic level by which people interact with computers. Discussion The field of study concerning the use of computers by humans is called as the human-computer interface (HCI) or also called alternatively as human-computer interactions (HCI). The basic premise of HCI is to study the optimal design of the interaction between people (the users) and the computers or machines they are using in order to give the maximum benefit and likewise avoid unexpected problems between man and machine. HCI is a multidisciplinary approach that utilizes several fields such as engineering design, architecture, computer graphics, the operating systems, and the software programming (confidentiality, integrity, and a vailability or CIA). It is supplemented by the human side of this knowledge such as linguistics, communication theories, cognitive psychology, the social sciences, and human factors like logic, ease of use, user satisfaction, memory recall, attention span, and user experience that contribute to desired results. There are a good number of engineering designs to observe as a guide when designing a human-computer interface (HCI) but it can be reduced to the basic principles which are a focus on the user, emphasis on the task to be performed, and actually measuring the real uses of this interface based on several or repeated simulations to detect any deficiencies and eliminate these. The designer or engineer of the HCI must firstly determine who will be the eventual users of the HCI, so that the final design will be suited for them. Secondly, the designer must know the tasks to be performed using the computer interface, specifically defining these tasks in detail, and also how often the se tasks are to be performed within the day, or during a certain work period. This will hopefully help establish the parameters to be used in the HCI design, using empirical ways or methods to determine the required benchmarks or performance levels (Sarmento, 2005). In order to be able to properly analyze the design issues of the new cash register

How to achive sustainable concrete Dissertation

How to achive sustainable concrete - Dissertation Example Therefore, all human activities should be sustainable such that they ensure correct use of the resources available (without waste) as well as ensuring that the environment is conserved. One such activity that should be sustainable in nature is the production and use of concrete. Concrete has been one of the most important materials in the construction and infrastructure industry for more than 2000 years now (Cement Association of Canada 2004). It has also been considered as an environmental friendly material (Cement Association of Canada 2004). In addition, structures made of concrete are normally durable, dependable and their performance in terms of are usually superior (Cement Association of Canada 2004). The question that now arises is how sustainable concrete is. As compared to steel and aluminium, concrete structures are flexible in design, affordability and environmental friendliness (Cement Association of Canada 2004). ... The research also aims at identifying how certain components of concrete such as cement and aggregate are not sustainable and suggesting ways of making them sustainable. The research will also discuss how these components of concentrate can be made sustainable. 3. PROBLEM STATEMENT Just as earlier mentioned, concrete has been used for construction material since time in memorial, and is considered as one of the most sustainable construction raw materials. It is however, noted that even though it is sustainable some of its aspects such as production of one of its major components, cement, is questionable. Therefore, what is a sustanaible development or product? 3.1 Sustainability In general, sustainability can be taken to mean supporting or keeping a process going. Therefore, the main aim of ensuring that projects, products and processes sustainable is to ensure that all the lives in our plat earth are sustained for a future that is foreseeable. Sustainability is consists of three com ponents; society, environment and economy. Therefore, a sustainable project, process or product must ensure that all the three components of sustainability (society, environment and economy) are maintained balanced and healthy at all times (both now and in future). 3.1.1 Evironmental sustainability It is the destruction of the environment that is driving the world towards adoption of sustainable ways of doing things. Our environment has been deteriorated countless times by countless causes such that the quality of life in the planet both now and in future is questionable. For example, environmental degradation has been blamed for poor health of planet earth and the constant decline of biodiversity. This is

Economic growth and convergence in poor countries Dissertation

Economic growth and convergence in poor countries - Dissertation Example d stimulation of the sales by means of advertising, personal sales, public relations and various material incentives addressed to consumers, agents and sellers; provision of price conditions, that include planning of the systems and price levels for provided goods, defining technology of price, credit, discount usage; satisfaction of technical and social norms of the region where the products are sold, which means the duty to provide appropriate security of product consumption and environment protection, accordance to moral norms, appropriate level of consumer value of the product; managing economic growth activity as a system, i.e. planning, carrying out and control of economic growth program and individual duties of each participant of production process; evaluation of the risks and profits, efficiency of economic growth decisions. The given paper will provide the analysis of the problems, which developing countries face on the way to economic growth and will prove that in order to stimulate economy, it is necessary to provide innovations in the field of marketing and management. Research analysis and limitations The research process should cover a number of stages. First and foremost, the detailed review of literature is performed, to identify the gaps in research and develop a clearer picture of contemporary management practices in the developing countries. The development of the research question was followed by the analysis of the available literature and potential research objects. Researched countries made the whole research relevant, efficient, and justified. The choice of Ukraine as an example was followed by the development of the research instrument and its analysis. The most important research findings include: The prevailing majority of developing... During the process of market-oriented reformatting a new model of economic development was shaped in many developing countries. It is characterized by high degree of economical openness towards foreign commerce. Many developing countries face the following problems:†¢Ã‚  Limited domestic demand, caused by total pauperization of the population and large-scale humiliation of pre-reforming savings. It leads to narrowness of domestic market, which produces a small volume of solvent demand, regardless of relatively big population. Under such circumstances export becomes a significant factor of economic growth, which is abnormal for economical security of the state, and affects the perspectives of the state influence on the processes of world economy. Market narrowness does not produce appropriate stimulus for investment in the state from domestic and foreign investors.†¢Ã‚  Unfavorable nature of investment climate, caused by incompleteness of the market-addresses institutional r eforms, high level of interference of state institutions and officials into economical activity, high rates of corruption, incompleteness of market infrastructure. It produces the narrowness of domestic market and detracts the capital flows from the country.For example, the crisis of Ukrainian economy was caused by insufficiently considered monetary policy of the government and influence of the structures that are interested in creation of economy of non-payment. Government is planning to remove these structures.

How to achive sustainable concrete Dissertation

How to achive sustainable concrete - Dissertation Example Therefore, all human activities should be sustainable such that they ensure correct use of the resources available (without waste) as well as ensuring that the environment is conserved. One such activity that should be sustainable in nature is the production and use of concrete. Concrete has been one of the most important materials in the construction and infrastructure industry for more than 2000 years now (Cement Association of Canada 2004). It has also been considered as an environmental friendly material (Cement Association of Canada 2004). In addition, structures made of concrete are normally durable, dependable and their performance in terms of are usually superior (Cement Association of Canada 2004). The question that now arises is how sustainable concrete is. As compared to steel and aluminium, concrete structures are flexible in design, affordability and environmental friendliness (Cement Association of Canada 2004). ... The research also aims at identifying how certain components of concrete such as cement and aggregate are not sustainable and suggesting ways of making them sustainable. The research will also discuss how these components of concentrate can be made sustainable. 3. PROBLEM STATEMENT Just as earlier mentioned, concrete has been used for construction material since time in memorial, and is considered as one of the most sustainable construction raw materials. It is however, noted that even though it is sustainable some of its aspects such as production of one of its major components, cement, is questionable. Therefore, what is a sustanaible development or product? 3.1 Sustainability In general, sustainability can be taken to mean supporting or keeping a process going. Therefore, the main aim of ensuring that projects, products and processes sustainable is to ensure that all the lives in our plat earth are sustained for a future that is foreseeable. Sustainability is consists of three com ponents; society, environment and economy. Therefore, a sustainable project, process or product must ensure that all the three components of sustainability (society, environment and economy) are maintained balanced and healthy at all times (both now and in future). 3.1.1 Evironmental sustainability It is the destruction of the environment that is driving the world towards adoption of sustainable ways of doing things. Our environment has been deteriorated countless times by countless causes such that the quality of life in the planet both now and in future is questionable. For example, environmental degradation has been blamed for poor health of planet earth and the constant decline of biodiversity. This is

Cold Blood and Frankenstein Essay Example for Free

Cold Blood and Frankenstein Essay Compare how Capote and Shelley use different techniques for characterisation and their use of emotive, figurative language with the use of repition to show the theme of wasted lives In Cold Blood was written in 1966 when screenplays were very common. Authors such as Shakespeare wrote traditional plays so it was unpredictable that the readers of In Cold Blood would respond to the novel well as it was the first non fiction novel Capote wrote. Capote wanted to experiment with his writing using narrative techniques of the novel to depict real life events. Capote believed that the narrator should not interrupt in novels; but the characters should tell the story themselves. Capote was able to write a novel which displayed the real events surrounding the murder of the Herb Clutter family and shaped it into a storyline. In Cold Blood is based on a true story of the murders of a family- something which would be wrote about in todays society. The novel is an account of the events but also contains elements of Capotes creativity therefore it is hard to tell whether it is fictional or factual. Frankenstein on the other hand is a non fictional novel which is still read and appreciated today as it is of a gothic genre. Frankenstein was written in 1818 when science was seen as exciting but also dangerous as it was trespassing on the territory of God. The early 19th century was a time which generated exceptional events and ideas therefore it must have been quite interesting to read Frankenstein. The danger of science was a great classic theme and Shelley provided her gothic genre as a framework to tone the horror of failed science- the famous experiment gone wrong. Frankenstein is still a very popular novel today because of its fascination in science which is still explored. Capote portrays his character Bonnie as being a very timid and shy character. She has a heart faced shape which is symbolic to her personality and it suggests that she is a likeable character. The significance of this is that it makes the readers engage with her and they want to know her story in order to feel sympathy for her. Bonnie has bony hands and is quite petitie which suggests that she is quite vunerable- like the creature in Frankenstein. In Frankenstein, we get the creatures perspective, and what was I? this is similar to Capotes character Bonnie with both the characters looking for reassurance from someone. Both the writers make it easy for the reader to discover new aspects of the characters personalities. Capote uses emotive language in repition to suggest that Bonnie may have had a wasted life which makes the readers have sympathy for her. Capote uses the term spinster aunt which is a type of semantic change known for an unmarried woman. Even though the novel was written in 1966, the language is still easily read and understood. Unlike In Cold Blood, Frankenstein contains language which may cause a barrier if read today. Shelley uses words like loathsome and squalid which would rarely be used today however the novel is still effective at portraying the gothic horror through emotive and figurative language. In the extract of the dialogue between Jolene and Bonnie, Capote portrays the significance of the difference between Bonnie and Jolene. Jolene is a very confident character whereas Bonnie constantly panicks and stutters when she speaks; this shows that she may feel worthless and may feel that she is not noticed by others. Capote emphasizes Bonnies wasted life indirectly by comparing her to Jolenes character who comes across as very confident. The comparison of the two characters is quite significant as it shows the importance of emotion that Bonnie has felt. Capote brings a child like quality to Bonnie through the dialogue between Bonnie and Jolene, They dont need me, this shows that Bonnie may be looking for reassurance from Jolene. Capote makes the reader feel sorry for Bonnie in order to like her character as she may have had a bad past. The repition of they dont need me reinforces the sadness of Bonnie. It is also suggesting how she may not be very close to her family. Capote makes us aware of the sadness and timidness of Bonnie for the readers to sympathise with her and hope that she succeeds later in the novel. The insecurities that Capote brings out in his character can resemble the characters of todays famous novels. Shelley makes the readers realise that even though the creature is deformed, he is still a character who underneath his flaws should be treated the same as any other person. I was not even of the same nature as man, this shows that Shelley wants the readers to sympathise with the creature and almost feel his emotion. The creatures life is empty if not more than Bonnies as all he longs for is companionship. Shelley makes the readers feel quite sad for the creature as he is deprived of love. With the use of figurative and emotive language, I saw and heard of none like me, Shelley introduces feelings to the reader which can only be seen as human. The readers see that the creature is still an outcast even though he has tried helping people and tried being humane. Its unfortunate for the creature to have an empty life, one which he didnt really ask for and like the one Bonnie almost wished she didnt have.

The effects unemployment has on crime

The effects unemployment has on crime Unemployment occurs when people are without jobs and they have actively looked for  work  within the past four weeks.  The unemployment rate is a measure of the prevalence of unemployment and it is calculated as a percentage by dividing the number of unemployed individuals by all individuals currently in the  labour force (the  International Labour Organization). There never occurs full employment in the country. But there are different methods of combating unemployment. There are some countries that reached a minimum unemployment figure. A good example of this are the post World War II era when there was a huge economic growth occurring. e.g. the United Kingdom in the 1950s and 60s when the average unemployment rate was at about 1.6 % (John Sloman (2004).  Economics. Penguin. p.  811), and in Australia in the 1945  government established a policy of full employment, which lasted until the 1970s when the government ran out of money. The latest statistics for UK unempl oyment is The unemployment rate stands at 7.7% down 0.1% over the quarter. 29.19 million people were in work in July to September according to the labour force survey (LFS). The number of people employed was up by 167,000 this quarter and up by nearly 300,000 from last year. (HRM Guide, 13 October 2010) As anyone can derive, there is a relationship between crime and unemployment. There have been a lot of studies into this topic as a low level of crime is socially desirable. Therefore, governments of all countries have tried to combat the problem of rising crime levels. A good example of the latter is post Soviet Russia. Crime rate in the 1980s increased to very high levels. This was the outcome of the collapse of the Soviet Union, because with it everything collapsed the law enforcement systems, social security, and minimal standard of living. And, obviously, these are the perfect conditions for an outbreak of crime. Extreme poverty and unpaid wages, which resulted from a suffering economy, have led to property crimes, theft and counterfeiting. By the early 1990s, theft, burglary, and other property crimes accounted for nearly two-thirds of all crime in the country.  There was a rapid growth of violent crime, including homicides.( Crime in the Soviet Era  Federal Research Division,  Library of Congress). In present times, though, Russia has done well in fighting this nightmare of crime. There are many other countries that have fought and are still combating this problem. By the use of the example of Russia, I wanted to show that unemployment is considered a very important cause of crime in any country, together with law enforcement problems and also labour market opportunities. Economic theories of the effect of crime on unemployment  « how many resources and how much punishment should  be used to enforce different kinds of legislation? Put equivalently, although more strangely, how many offenses should  be permitted and how many offenders should go unpunished. Gary Becker (1968). Becker (1968) is considered to be the first work which formally analyses the issue of crime using an economic model. Becker links the problem of crime to social welfare. It is assumed that criminals are as rational as any other person. And, therefore, if they are involved i n crime activities, it means that they are better off by doing so. The issue of opportunity cost comes up quite frequently in these discussions. If a potential offender, despite the knowledge that he has about the punishment he will get if he commits a crime, still goes and does it it means that the reward that he is aiming at justifies the probability of him getting caught and convicted. When looking at crime, the concept of rationality is applied not only to criminals, but to all parties involved judges, policemen, legislators and potential victims. So, when the institutions that control crime are designed, their main concern is not the crimes that are committed and how much they weigh, but the costs that occur to the society. As an example, if it takes half of the population to be turned into judges, policemen, etc in order to decrease the crime rate by 70%, it would probably not happen in the real life, because the cost of doing so is too high. Becker constructed a model, which identifies optimal levels of punishment by minimising the social c ost induced by both combating crime and crimes themselves. This model predicts the aggregated supply of offences. The number of offences a criminal would commit, according to Becker, would be negatively related to the probability of apprehension and the severity of punishment. It also includes a certain u term, which includes all other variables that can influence the predicted outcome e.g. income from legal and illegal activities, education, risk aversion, etc. But, this variable u is not explicitly studied by Becker. This work was later on continued by Ehrlich (1972, 1973). Ehrlich states that a person is able to spend time on both legal and illegal activities, but the amount of time that one dedicates to any of those activities depends on the amount of utility (return) that he gets from it. By 1973, Ehrlich designed a mathematical model that describes this relationship. Ehrlich bases his model on the decision making under uncertainty theory. The assumption used is that a person can switch between legal and illegal activities during their lifetime, depending, as I have mentioned earlier, on the amount of utility they get from them (activities). There is no training and no costs involved in changing between the two. So, it is obvious, that an increase in opportunities in the legal market, e.g. higher probability of employment and higher wages would increase the expected utility gained from legal activities and so and individual, being rational, would spend more time on legal, rather than illegal deeds. Therefore, keeping a low level of unemployment, in theory will decrease the crime level. Cohen and Felson (1979) have proposed that in order for a crime to be done, it need three factors to be satisfied: motivated offenders, suitable victims and the lack of effective legal punishment system. Leading from this, the increase in crime production is caused by an increase in the first two factors under the third an ineffective legal system. This argument only supports the prediction made in Ehrlichs model. We can deduce a positive relationship between the rate of unemployment and the crime rate. On the other side of the argument, Cantor and Land (1985) have predicted a negative relationship between the rate of unemployment and crime based on the works of Cohen and Felson. They suggested that the higher the unemployment, the less people there are in the second category (suitable victims). If there are more unemployed, those who lost their jobs stay at home and therefore avoid the risk of having their house robbed, for example. Also, a higher rate of unemployment is a sign of a recession, which means that there is less for the offenders to steal, for example. So, higher unemployment may reduce property crimes. Also, using the same logic, we can deduce a reduction in violent crimes again through a reduction in that second factor suitable victims. Statistically, most violent crimes are committed by strangers, so if you stay at home, you avoid that risk. Cantor and Land have designed an empirical model which tests the motivation and opportunity effects of unemployment rate on crime. There are several equations under estimation. The dependant variables include the differentiated levels of crimes like homicide, rape, assault, robbery, theft, burglary, etc. Independent variables are either up to date or differentiated unemployment rates. The argument in this paper is that in case of a financial crisis those that become unemployed will receive some unemployment benefits, etc. And therefore they might not turn to criminal activities straight away, but after they are under financial pressure in case unemployment benefits or an alternative source of income expires. This model has been criticized by several researchers in this area. For example, Greenberg in 2001 has argued that those who become unemployed might not have the sufficient resources to keep themselves, while out of work. This factor might make them engage in illegal activities, which contradicts the outcomes on the Cantor and Land model. He also questioned the mathematical approach of the model. Greenberg (2001) claimed that it is mathematically unacceptable if the differencing procedure is only carried out on the crime rates but not the explanatory variables. Also, Hale and Sabbagh (1991) have questioned mainly the empirical work of Cantor and Land. The ideas of integration and cointegration were introduced to show that their models  are mis-specified. Leading from this, it is argued that any conclusions drawn from their work are probably unreliable. There are other papers that only try to derive the net effect of unemployment on crime, rather than taking into account motivation and opportunity costs. A good example is a paper written by Fleisher (1963). In it, the author argues that there is a positive correlation between parent unemployment and youth crime. If there is a high level of unemployment in the country, adults become unemployed and it becomes very hard for them to provide for their children, who, therefore, might turn to illegal activities. Fleisher uses time series data to test this relationship because it gives a more thorough view of the relationship of different variable in a long period of time. The prediction of the model is justified using an OLS estimation and shows a positive and significant correlation between unemployment rate and youth crime. Some researchers preferred to use panel data to investigate this area. For example, a paper written by Raphael and Winter-Ebmer (2001) uses this approach. The argument in this paper is that there is a dependent relationship between crime and unemployment. One might be the cause of the other. E.g. high crime rates in the country will deter investment and so add to an increase in unemployment, which is what happens in countries like Russia. Because Russia is known for white-collar crime, it is a serious obstacle to foreign direct investment. (Forbes.com). Also, people who have had a criminal record might find it very difficult to find a job a so remain unemployed. The results of the OLS estimations of the model are the following: there is a positive relationship between unemployment and property crimes, but, on the other hand, there are insignificant results regarding the relationship between unemployment and more severe crimes like rape and murder. Although, one very interesting point of findings of this paper is the negative relationship between unemployment and murder. The explanation of this can potentially be found in Ehrlichs three factor model. Unemployment could decrease the potential interaction between a criminal and a victim.